sung
sung
I have the same warning as well - Pop!_OS 22.04, and just updated medaka with conda (in its separate environment). I'm pretty sure I didn't get this message with 1.5.0...
> Having said that, I hear from a couple of colleagues that also other connections to the NCBI FTP servers die with the same issues, regardless of if the HTTPS...
There seems to be a number of same issues describing this exact problem on the issues page. For future reference, if you're seeing the same message it almost exclusively means...
I tried running both a conda installation and docker installation of LongQC. I'm not quite sure if this applies to everyone, but only the conda installation terminates with this error...
Quick follow up: I tested out fresh PhiSpy installations across two separate machines running the same OS (Ubuntu 22.04 LTS), running same commands on conda-installed PhiSpy environments. Curiously, the command...
Ah that's good to know, shame about Pfam changing their database around but I'm happy I could help a bit. For those reading this, workaround is as @AstrobioMike described. Just...
Hi, thank you for the prompt response. Copying in the first ten protein sequences from the fasta file for reference ``` >WP_004215311.1 ~~~30S ribosomal protein S10~~~ MQQARVRLAGTSPDDLDDICDDVREIANNTGVNLSGPIPLPTKTLEVPTRKSPDGEGTATWEHWEMRVHKRLIDLDADER ALRQLMRIQVPNDVSIEIVLED >WP_004267621.1 ~~~50S...