chrismun

Results 5 issues of chrismun

SubcellularLocalization Dataset error

1 comment

".../protein.py", line 301, in from_sequence raise ValueError("Invalid sequence `%s`" % sequence) ValueError: Invalid sequence `MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQCQ` Error loading the SubcellularLocalization dataset, I get a similar error with the BinaryLocalization dataset, however...

multidimensional gangs update

removed routines in tests and added fortran and cpp

New init shutdown device

testing force modifier on loop construct collapse clause

Testing force modifier to loop construct collapse clause. New feature to 3.3 Line 787 of OpenACC spec 3.3. Appears unimplemented in nvc 24.7

update acc wait any test

acc_wait_any routine added in version 3.2 of the spec. Line 770 passes with nvc 24.7