openfold
openfold copied to clipboard
AttributeError: 'dict' object has no attribute 'new_ones'
When I installed teh ESM,I can easy fllow this code:
import torch
import esm
# Load ESM-2 model
model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
batch_converter = alphabet.get_batch_converter()
model.eval() # disables dropout for deterministic results
# Prepare data (first 2 sequences from ESMStructuralSplitDataset superfamily / 4)
data = [
("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"),
("protein2", "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
("protein2 with mask","KALTARQQEVFDLIRD<mask>ISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
("protein3", "K A <mask> I S Q"),
]
batch_labels, batch_strs, batch_tokens = batch_converter(data)
batch_lens = (batch_tokens != alphabet.padding_idx).sum(1)
# Extract per-residue representations (on CPU)
with torch.no_grad():
results = model(batch_tokens, repr_layers=[33], return_contacts=True)
token_representations = results["representations"][33]
# Generate per-sequence representations via averaging
# NOTE: token 0 is always a beginning-of-sequence token, so the first residue is token 1.
sequence_representations = []
for i, tokens_len in enumerate(batch_lens):
sequence_representations.append(token_representations[i, 1 : tokens_len - 1].mean(0))
# Look at the unsupervised self-attention map contact predictions
import matplotlib.pyplot as plt
for (_, seq), tokens_len, attention_contacts in zip(data, batch_lens, results["contacts"]):
plt.matshow(attention_contacts[: tokens_len, : tokens_len])
plt.title(seq)
plt.show()
But when I fllowed next code:ESMFold Structure Prediction
import torch
import esm
model = esm.pretrained.esmfold_v1()
model = model.eval().cuda()
# Optionally, uncomment to set a chunk size for axial attention. This can help reduce memory.
# Lower sizes will have lower memory requirements at the cost of increased speed.
# model.set_chunk_size(128)
sequence = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
# Multimer prediction can be done with chains separated by ':'
with torch.no_grad():
output = model.infer_pdb(sequence)
with open("result.pdb", "w") as f:
f.write(output)
import biotite.structure.io as bsio
struct = bsio.load_structure("result.pdb", extra_fields=["b_factor"])
print(struct.b_factor.mean()) # this will be the pLDDT
# 88.3
I got :
Traceback (most recent call last):
File "/home/amax/biodata/esm_test/test_esmfold2.py", line 15, in <module>
output = model.infer_pdb(sequence)
^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/esm/esmfold/v1/esmfold.py", line 312, in infer_pdb
return self.infer_pdbs([sequence], *args, **kwargs)[0]
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/esm/esmfold/v1/esmfold.py", line 307, in infer_pdbs
output = self.infer(seqs, *args, **kwargs)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/torch/utils/_contextlib.py", line 116, in decorate_context
return func(*args, **kwargs)
^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/esm/esmfold/v1/esmfold.py", line 282, in infer
output = self.forward(
^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/esm/esmfold/v1/esmfold.py", line 180, in forward
structure: dict = self.trunk(
^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/torch/nn/modules/module.py", line 1553, in _wrapped_call_impl
return self._call_impl(*args, **kwargs)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/torch/nn/modules/module.py", line 1562, in _call_impl
return forward_call(*args, **kwargs)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/esm/esmfold/v1/trunk.py", line 203, in forward
structure = self.structure_module(
^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/torch/nn/modules/module.py", line 1553, in _wrapped_call_impl
return self._call_impl(*args, **kwargs)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/torch/nn/modules/module.py", line 1562, in _call_impl
return forward_call(*args, **kwargs)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/amax/miniconda3/lib/python3.11/site-packages/openfold/model/structure_module.py", line 594, in forward
mask = s.new_ones(s.shape[:-1])
^^^^^^^^^^
AttributeError: 'dict' object has no attribute 'new_ones'
I used openfoldv1.0.0 not the latest version!!! Could any teacher tell me how to solve this problem? Thanks!!!!
Same problem. Did you solve this?