translated sequence panel should indicate stop codons with '*' explicitly

[nathandunn]

from @strumpfe

Another potential suggestion for the Sequence panel, though one that usually divides opinion, is should the peptide translation include the stop codon? The use case is that opening the sequence panel for a given prediction will quickly confirm the presence of both the initiation methionine (starts with a M) and the stop codon (ends with a *). I know some people dislike the trailing stop but I quite like it. Maybe one to put to a wider audience to see if others like/hate.

What I was proposing is that when viewing the peptide sequence (default view) you would get something that included the '*' symbol for the stop codon. Like this..

>header
MSLSLDYTSVETILLKNEGDFISVGEQGTKGELQSTQRKKQQREEHMRQLLDVTNTLTTEEIKDFEM*

[nathandunn]

May be a check-box to flag on and off in the display.

[nathandunn]

as well as setting a default.

[nathandunn]

I think it should match what is in the sequence panel for simplicity (which is what @strumpfe is requesting):